PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC347_p3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 309aa    MW: 34303.9 Da    PI: 8.6587
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC347_p3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.66.6e-393392261
     zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                +++lkcprC+s+ntkfCyynnyslsqPr+fCkaCrryWt+GGalrnvP+Ggg+rk kks
  RrC347_p3 33 DQQTLKCPRCNSSNTKFCYYNNYSLSQPRHFCKACRRYWTRGGALRNVPIGGGCRKTKKS 92
               57899***************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-342091IPR003851Zinc finger, Dof-type
PfamPF027013.4E-333591IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4973791IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MSSHTNLHSP KPDHRTTGTS HTKKPPSSSA SQDQQTLKCP RCNSSNTKFC YYNNYSLSQP  60
RHFCKACRRY WTRGGALRNV PIGGGCRKTK KSFKPNSAIT PSSSSSQRFF SSIMEDSTKF  120
FPPPTTMDFQ LAGLSLNKIN DLQLMNTQEV LGLRPMDQVE TTPVDVGSGL SLMGFGDYNS  180
NNNNNHSSGT FTTAGATDGN LATSIETLSC LNQDLHWRLQ QQRMAMLFGS SKEETVVVER  240
PQPILYRNLE IVNSPPSPTK KGDNQTEWYF GNNNNDNEGV ANNNNTGGSE QWNNGVQAWT  300
DLNHYNAMP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013728157.10.0PREDICTED: dof zinc finger protein DOF5.7-like
SwissprotQ9LSL61e-177DOF57_ARATH; Dof zinc finger protein DOF5.7
TrEMBLA0A078JTF50.0A0A078JTF5_BRANA; BnaCnng70020D protein
TrEMBLA0A0D3BEQ40.0A0A0D3BEQ4_BRAOL; Uncharacterized protein
STRINGBra024399.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49502850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.11e-163Dof family protein